PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.008G155000.1
Common NameB456_008G155000, LOC105764221
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 428aa    MW: 47088.4 Da    PI: 8.1905
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.008G155000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like871.8e-27156210156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  Gorai.008G155000.1 156 KVKVDWTPELHRRFVQAVEQL-GLDKAVPSRILELMGIQCLTRHNIASHLQKYRSH 210
                         5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.468153212IPR017930Myb domain
SuperFamilySSF466896.45E-18154213IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-26154213IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-26156210IPR006447Myb domain, plants
PfamPF002494.8E-8159208IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MLAVSPLRNT TEDENKGAME SFRFNISSEE FPDFYHGNLL ESIDFEDLFV DGYVLPDLEM  60
DPEILAELPA PGGEDPEMNV SVEETGDGYN QRKEEEGKVS DPGSSSGSAL GWSRSKGEEI  120
VSKREEGRAV KTTLKDADKG RKSPAQAKNN NQGKRKVKVD WTPELHRRFV QAVEQLGLDK  180
AVPSRILELM GIQCLTRHNI ASHLQKYRSH RKHLLAREAA TVASWTQKSQ ICGAATTPAG  240
GGKRDKNPWL APTMGFPPMS PSSPLHHHFR PLHVWGHPTV DQSLIHLWPK HLAPPPPPPR  300
PTWEPPRAGP SYWHHHPKRV TNGISPGTPC FPQPLPLATR RFAAAPVPGI QPHHGTMYKA  360
DPGIGVRSRP HPLMDFHPSK ESIDAAIGDV LSKPWQPLPL GLKPPASDTV LGELQRPGLP  420
NIPPFSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-14153208257ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438187.10.0PREDICTED: transcription activator GLK1-like isoform X1
SwissprotQ9SIV32e-97GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A0D2U3U20.0A0A0D2U3U2_G
STRINGVIT_12s0028g03100.t011e-159(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22092773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.17e-89GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]